SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507958|ref|YP_003572016.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507958|ref|YP_003572016.1|
Domain Number 1 Region: 27-430
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.84e-88
Family Glycosyl transferases group 1 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294507958|ref|YP_003572016.1|
Sequence length 435
Comment group 1 glycosyl transferase [Salinibacter ruber M8]
Sequence
MPPRPLNPPVATSSSPSLFADRPPKPMRIAILTNEYPPNVYGGAGVHVEYLTRELAKLED
GRHEIEVLCFGAQDETHDNLRVRGIDPDMEVPHQDERHAKFMDAMARDLVMAGSVADADI
IHGHTWYSHLAGCLAKQLTGGQLVLTTHSLEPHRPWKREQLGRGYDGSSWVEQTAYETAD
GVVAVSGAMEDDVQSLYDVSGADTQVIHNGIDIEQYRPRPDRSTLEDYGVDPDRPFVLFV
GRITRQKGILHLVEAIRHFDPDIQVVLCAGAPDTEEIGAEMEARVEAVRAETENRIVWLA
EMLPREDVITMYTHASVFVCPSVYEPFGIINLEAMACETPIVASRVGGIPEIVVPDETGL
LVDVDPTGGDDVEPAAPEAFAHGLADGVNALMRDPDRREQMGTAARRRVEAQFSWTAIAE
QTLGFYKSLVDDGHS
Download sequence
Identical sequences D5HAK9 Q2S191
WP_011404665.1.91540 YP_446040.1.20240 309807.SRU_1930 gi|294507958|ref|YP_003572016.1| gi|83816539|ref|YP_446040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]