SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507972|ref|YP_003572030.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507972|ref|YP_003572030.1|
Domain Number 1 Region: 9-184,227-272
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.27e-58
Family FAD-linked oxidases, N-terminal domain 0.042
Further Details:      
 
Domain Number 2 Region: 277-532
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.59e-53
Family D-lactate dehydrogenase 0.075
Further Details:      
 
Domain Number 3 Region: 498-640
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 0.00000000000523
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507972|ref|YP_003572030.1|
Sequence length 985
Comment glycolate oxidase subunit [Salinibacter ruber M8]
Sequence
MPAPSASPAQTPPLAEALRPRISGTVHTDEMTRALYATDASMYAMSPVAVLVPETKADVQ
TALTVAHEQGVPVLPRGGGSSLAGQGVNEALVVDFTNHLNRIHEIDPEAQTARVEPGVTL
AELNRAAAEHGLMVGPDPASANRATLGGMLANNSTGTHSIAYGNFIHHVREAEVLLADGT
ATTVGPTDPATWQDKMRDDGLEGAIYRGLKALLADGGRETIREDTPSHWRRNNGYRLEAL
LDEAPNLAKLLCGSEGTLAVTTELTCDLVEKPATTGLGVVHFESRDDALRAVTTVLDTDP
SAVELFDGVAIERTLQTPGYAERLTFLEGTPGSVLITEYAGDTDAEVDAALDALEQTMAE
ASRGYATVRVTEPDAIKNVWSIRKEGLGLLMGVEGDYKPWAFIEDASVPVENLADYIDEL
STFVDATDTRAAYYAHASAGCLHVRPFVNTKDETEVEKMTDIAKESLDLVTKYGGVVSSE
HGDGIARGWANPHILGEDLYELCRETKALFDPEGILNPGKVVDAPPMDENLRMGPTYETE
PFRTELDFSEDGGFTGAIEKCNGNGACRKLRAGTMCPSFMATREEPDSTRGRANALRSAL
AGDLSEDAMTGDDMHEVMDLCVQCKACKTECPSNVDMAKIKTEWLHHYWDDNGVPLRTRL
FARQPDAARWISGTPLASLVNWASGQSALRQVGEALLGVSAERPLPPFARETFRQWFQNQ
QPPVGGDGARGPRVVLFPDAFNAYHTPAPLRAATRVLQATGHRVELPPAAVGSARTLLSK
GLVPQAKRRARQTVDALHAYAEAGVPVVGLEPSSILTLRDEFLDLLPNDARAEAVADAAY
TFAEYLAERAEDGALDRASWRGSGDVLLHGHCHQKALIGTTATEQALSRAGYDVTAVDAG
CCGMAGAFGYEAEHVDVSKQMAELRLAPAVRQTDADTRVAAPGFSCRSQIKDVTTRTAQH
PAELLWDAIEHDRSPEAARSSRPAR
Download sequence
Identical sequences D5HAM3
gi|294507972|ref|YP_003572030.1| WP_013062340.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]