SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508072|ref|YP_003572130.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508072|ref|YP_003572130.1|
Domain Number 1 Region: 8-373
Classification Level Classification E-value
Superfamily Activating enzymes of the ubiquitin-like proteins 1.96e-107
Family Molybdenum cofactor biosynthesis protein MoeB 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294508072|ref|YP_003572130.1|
Sequence length 405
Comment Molybdopterin biosynthesis protein moeB [Salinibacter ruber M8]
Sequence
MPTTTTDPNQKQAELSPDELQRYSRHLTLPEFGREGQEALKNASVLLVGAGGLGSPAATY
LAAAGVGRIGLVDFDSVEASNLQRQILYGTSDVGRPKLDAASERLEDLNPHVDVETHEVR
LTSDNALDIIDQYDVVADGTDNFPTRYLVNDACVMTGTPNVYASIFRFEGQVSVFATEDG
PCYRCLYEEPPPPGLVPSCAEGGVLGILPGFIGTLQATEVIKVLTGVGEPLVGRLLMSDA
LNMDFRTVNVPTNPECPVCGDDPTVTELIDYEAFCGLPQSDESSPNGTADSDVSDTDDAV
PETSVHDLKQRRDAGDAPFVLDVREPYEAEIASLDADQLIPVDDLEARLDELDAGPEEEI
VVHCRSGARSAKATAFLREQGYDASNLEGGVLAWSEEIDDSVPQY
Download sequence
Identical sequences D5HAX3 Q2S0Y3
WP_011404770.1.91540 YP_446148.1.20240 gi|83815308|ref|YP_446148.1| gi|294508072|ref|YP_003572130.1| 309807.SRU_2042 SrR155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]