SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508095|ref|YP_003572153.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508095|ref|YP_003572153.1|
Domain Number 1 Region: 74-301
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.83e-60
Family Prokaryotic proteases 0.00000854
Further Details:      
 
Domain Number 2 Region: 276-382
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-21
Family HtrA-like serine proteases 0.023
Further Details:      
 
Domain Number 3 Region: 442-506
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000067
Family HtrA-like serine proteases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294508095|ref|YP_003572153.1|
Sequence length 514
Comment serine protease do-like [Salinibacter ruber M8]
Sequence
MASSSGRPARLLAGIGLVLVGLLAGVLVMLLAEEESDTAQVARIVERAGTVEEAGTTRTA
SVPRDWQTDGPPPAALNRLFRDVAEDVTEGVVSIRVASSAEGDGENPLGQPAQNLGSGVV
ISPEGYIVTNSHVVEGAERIQVRLTDKRQFKARVVGTDASTDLAVIKVDGEDFSVVPFGN
SDQVQVGDWVVAVGNPLQLTSTVTAGIVSALGRQLRIIEDQFRIENFIQTDAAINPGNSG
GALVNLKGELVGINTAIASRSRRTEGYGFAIPSALVERVVTDLIAYGEVRRGYLGVSILP
VDADRAEEIGLRDIRGVYLEEVQSGSAADRAGLEGGDVVISIMGEPVNAPNDLQSLIARQ
RPGDTVAVEVWRDGTARTFGVELMGEDTPVYQEWLSDLQSGGAPNSDPPEYQPPDDGGAD
AAVTEVDGWDVGLRPLTDTEASVFDADAGAYVAYVESGGRAAAAGLPRNVVMTRLDDTRI
ESPADVVQHLSAASGPVLVEVQRRDGTPAFYEIE
Download sequence
Identical sequences D5HAZ6 Q2S0W1
gi|83815454|ref|YP_446170.1| gi|294508095|ref|YP_003572153.1| WP_011404792.1.91540 YP_446170.1.20240 309807.SRU_2064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]