SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508118|ref|YP_003572176.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508118|ref|YP_003572176.1|
Domain Number 1 Region: 6-374
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.49e-90
Family Glycosyl transferases group 1 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294508118|ref|YP_003572176.1|
Sequence length 382
Comment group 1 glycosyl transferase [Salinibacter ruber M8]
Sequence
MKVGITCYPTYGGSGVVATELGKALAERDHEIHFIASDLPFRLSHVAGNIFFHEVNVQSY
PLFDYPPYTLSLTSKMVDIAKHVGLDLLHVHYALPHASSAVMAQQILSSEDLDLPIVTTL
HGTDITLIGRDPSFAPVVTWSINESDGVTAVSDYLRQETYDHFEVSEDVEVIPNFIDTDR
FVRQDKEHFKQALCPNGEKVIVHVSNFRPVKNTDQVVEVFHRLQNGTSNVKLLLVGDGPD
RVPTERKARELGVYDDIRFLGKQDPIEEILSIADVFLMPSGSETFGLAALEAMACEVPVV
ASDVGGLPELVVHGETGFLCQLDDVDAFTEHTRTLLHDEDQHAEMAAAARKRAVETFDID
RVVPLYEDYYERVRSGTVHTGA
Download sequence
Identical sequences D5HB19 Q2S0U0
309807.SRU_2085 gi|294508118|ref|YP_003572176.1| gi|83815953|ref|YP_446191.1| WP_011404813.1.91540 YP_446191.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]