SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508161|ref|YP_003572219.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508161|ref|YP_003572219.1|
Domain Number 1 Region: 180-345
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 1.31e-45
Family Succinyl-CoA synthetase domains 0.0000127
Further Details:      
 
Domain Number 2 Region: 539-749
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.33e-43
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 345-501
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 5.1e-40
Family Succinyl-CoA synthetase domains 0.00021
Further Details:      
 
Domain Number 4 Region: 53-181
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.42e-37
Family CoA-binding domain 0.00013
Further Details:      
 
Domain Number 5 Region: 759-927
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.54e-26
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294508161|ref|YP_003572219.1|
Sequence length 940
Comment acyl-CoA synthetase (NDP forming) [Salinibacter ruber M8]
Sequence
MLVRSVGPLFPARENVSSNDVPRPMPDSSSVPSDTTPTSDPSYDLVGSRRQPLDAIFEPK
NVAVIGASESPGSVGRTLLWNLVSNPFGGTVFPVNPKRDSVLGIEAYEGIGAVEADVDLA
VIATPAPTVPGIVEQCGEAGVEGLVIVSAGFREVGEEGAALERDIKDIARTHGIRIVGPN
CLGIMRPPNGLNATFAGSMANEGDVAFVSQSGALLTSILDWSFRENVGFSSFVSIGSMLD
VDWGDMIEYLGDDPKTESIVLYMESIGNARSFLSAARDVAQSKPIIVIKAGRTDAAAEAA
ASHTGTLTGSDAVLNAAFRRSGVLRVDDINDLFYMAEVLSKQPRPEGRNLTILTNAGGPG
VLATDALIGGGGELTPISEDATDAFDDILPGAWSHGNPVDILGDADPERYAESLEVAAND
ENSDGLLVVLTPQAMTEPTKTAEHLRPYARDNDKPILASWMGGDAVASGENILNESGLPT
FAYPDTAARVFNHMWRYSYNLRALYETPSLPEDEPGLPDREAAAGIVQDTHESGRVLMTE
HASKELLAAYGIPTVDSPVAETPEEAVAAAQEIGYPVVVKLHSTSITHKSDVGGVHLGLT
SDADVEAAFAQVENNVAEGFDGVTVQPMIDRSDGYELIIGSSMDEQFGPVLLFGSGGQLV
EVYQDRALGLPPLNRTLARRMMEQTQIYEALQGVRGREPVDLDALETLLVRFSQLVVEQP
RVKEIDVNPLLARPGDDGLLALDARVVLHPYTKDDDELPTPAIRPYPRQYVGTHAMADSE
EVTIRPIRPEDEPKLVTFHERLSERSVYLRYANLMKLEQRVAHDRLARICFIDYDREMAL
VAERPTEDGDDRIIGVGRLTQQPGRNEAEFAMLVIDEYQGEGIGTELLRRLVEVGTTEGL
DRITADILQQNHAMQRVCEKLGFEVVRGDGREMVQAVKTL
Download sequence
Identical sequences D5HB62
gi|294508161|ref|YP_003572219.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]