SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294508193|ref|YP_003572251.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508193|ref|YP_003572251.1|
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.93e-35
Family Thioltransferase 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|294508193|ref|YP_003572251.1|
Domain Number - Region: 115-174
Classification Level Classification E-value
Superfamily TPR-like 0.011
Family Transcription factor MalT domain III 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294508193|ref|YP_003572251.1|
Sequence length 270
Comment Thioredoxin [Salinibacter ruber M8]
Sequence
MSYEVNDFETDVLDASADTPVLVDFWAPWCGPCQQLSPVLESLAEATDDWTLVKVNVDDH
PSAAQEYGVRGIPAVKLFVEGDIEAEFAGVKPKPQLESWLDEHLPSEEKSRIEEAKEALE
AGSHQEAEHLLWPVLEDNPDHDEAQVLMARALAFKDPNRAQVLAQEAEVADPTLRQMRDG
VETIARLLELAEDPSALPENGVKDTYVAALDALADQDFDAALDQFIDVVRTDRNYDDDGA
RKACVALFTLLGEQHPVTQEHRRTFDMALY
Download sequence
Identical sequences D5HB94
gi|294508193|ref|YP_003572251.1| WP_013062459.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]