SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508463|ref|YP_003572521.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508463|ref|YP_003572521.1|
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 7.46e-17
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.0015
Further Details:      
 
Weak hits

Sequence:  gi|294508463|ref|YP_003572521.1|
Domain Number - Region: 97-139
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.00549
Family Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294508463|ref|YP_003572521.1|
Sequence length 149
Comment ATP synthase subunit epsilon [Salinibacter ruber M8]
Sequence
MADELTVDIVTPDERSFQGPANGVRAPGIEGSFEVREDHAPMIAAFGIGPLIVKTQAAHE
YADMHNDRIIFATSGGFLEVIDNKVTVLAETVEPASEIDVERAESAEERAKRRLEEGVQE
EERETHEAARDRARNRLRVAMGKVGTRQS
Download sequence
Identical sequences D5HC14 Q2RZV2
WP_011405147.1.91540 YP_446529.1.20240 309807.SRU_2430 gi|83814642|ref|YP_446529.1| gi|294508463|ref|YP_003572521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]