SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508716|ref|YP_003572775.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294508716|ref|YP_003572775.1|
Domain Number - Region: 217-278
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 
Domain Number - Region: 148-210
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0379
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294508716|ref|YP_003572775.1|
Sequence length 380
Comment hypothetical protein SRM_02902 [Salinibacter ruber M8]
Sequence
MVADCVPPWRASAAPSPPVSGLALDLLPLMLFLVVVSRTSGALTASFSSSASGNCRGALV
LLCRHAEQGLRPVVPGPCRPLPPVSLATASQAMRLPPPLRALLNWFRTLLRNTYFWGGLG
GLLLLGVGAYFLVDAVLMPTYTRHGVSVQVPNVESQSFLEAKKRIEARDLQVKREVGRFN
PNVPRETVVDQNPPPNSGVKPGRRVYLTVNAGEAPVVNIPDLNGISVREAKNRVSSLGLA
VGTVEPDSLPSPYPNTITRQRPEPGDSLKTGGTVDLWYSTGLGTDTVQVPNIAGRAVERA
RRLLRARQLRAIVLDPRTADPSDAPSQPSDTSSSRRFVQRQGRAPTTKVRAGTEIRLFTT
DDSTAVPKPDSIAQDTTAPS
Download sequence
Identical sequences D5HCR8
WP_013062838.1.91540 gi|294508716|ref|YP_003572775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]