SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508845|ref|YP_003572904.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508845|ref|YP_003572904.1|
Domain Number 1 Region: 85-302,353-421
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 7.19e-53
Family Zn-dependent arginine carboxypeptidase-like 0.019
Further Details:      
 
Domain Number 2 Region: 468-577
Classification Level Classification E-value
Superfamily NTF2-like 1.34e-19
Family Atu0742-like 0.0075
Further Details:      
 
Domain Number 3 Region: 37-86,423-462
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.0000000000000921
Family Hydantoinase (dihydropyrimidinase) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294508845|ref|YP_003572904.1|
Sequence length 580
Comment amidohydrolase [Salinibacter ruber M8]
Sequence
MTALSAMRRLWILFLLAGLFPLGPAAAQPTALVGPTALNPADSTVIEDATVLWEGDRIAA
VGPSSEVAVPPGATVHKMPDKYVMPGLVDGHVHFFQSGGLYTRPDVIDLRAERPYAEELR
RIKERLPDTFRRYLRSGVTSVVDVGGPMWNLDVRARADTAAMAPTVVTAGPLLSSVARPS
LDEGDPPILQITTPEAARKEVRDQIMAGVDLIKIWYIVGGDETPADYRPVVEATIDEAHN
AGTRVAVHATALETARAAVEAGADILVHSVSDQPVDDAFVQLLRENDVLYTPTLVVGERY
GETFAQQLDLTLAEHRIGQKDVINSLTDLRTLPDSLVPTGLRRRIRQAPTVPSDTTAMRN
LKRLYEAGIDVVAGTDAGNIGTPHGPALFREFELMRTAGLTPREILATATAGGARLMGRD
DLGRIEDGMMADLVVLNRDPFADIKHVTSIHRVVKEGRMYAPDRLVPRTPAEVVFQLHNA
YNTHDPDAFLDALADDVKVYRPPNTLVMEGRDTLATQYRPLLEGATNLHSEFHYHTTVGP
TFTAHETIRNLPGRETPLSQVLLYRVTDGAIDRAWLVQEE
Download sequence
Identical sequences D5HD47
gi|294508845|ref|YP_003572904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]