SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508856|ref|YP_003572915.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508856|ref|YP_003572915.1|
Domain Number 1 Region: 833-1056
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.97e-54
Family Multidrug efflux transporter AcrB transmembrane domain 0.00013
Further Details:      
 
Domain Number 2 Region: 301-502
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.09e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.00028
Further Details:      
 
Domain Number 3 Region: 43-127
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.46e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.005
Further Details:      
 
Domain Number 4 Region: 151-187,278-334
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.54e-18
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.011
Further Details:      
 
Domain Number 5 Region: 751-834
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.05e-16
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0066
Further Details:      
 
Domain Number 6 Region: 188-275
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000458
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0076
Further Details:      
 
Domain Number 7 Region: 594-692
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000314
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294508856|ref|YP_003572915.1|
Sequence length 1082
Comment Cation efflux system protein czcA [Salinibacter ruber M8]
Sequence
MFDRLVTSVVKNRILVLLLMAVLVGWGLYSWQQVPVDAYPELTNNQVQILTRVPGMSPVE
VEKLVSYPIETSMTNLEGVTDNRSLSQFGLSVVTLVFEEDMDPYFVRRLVSQRLSKVKED
LPEKAEPGLGPLSTALGQVYQYTLTDEPGDGRSYSARALRTMQDWILAPELRTVEGVVEA
NALGGFVKQYHVRFRPDQLMNHGLSLDEAYAALRESNQNVGGSYITRNDQQYVVRGVGRL
GAGDGTVVEDIENTVITSRDGTPVLTSDVADVEVGHAVRYGAATADGEGETVVGIVMMRR
GANAQKVVNSVQAKMDELKQALPPGVGVDVYYNRNELTSAAISTVTTSLLIGGLLVLLVL
VGFLGDWRSALIVSLVLPMTALITFILMNYFGFKANLMSLGGLAIGLGMFVDGAIVMVEN
IYRLREENPDASIGLIVVRAGREVARPIAFSVGVVVAVFLPLFTLQQMEGRMFRPMAFTV
SFALMAALLLALTMAPALSSYLLASVGNSGKPPDAADGSPQENGAPTRPADGSPGASANS
QTRVVAALQSVYEPLLDAALTHRWATVGTAVVVVGLGAGLFSTLGTEFAPDLEEGSVAIQ
VALEPDAALETSTEVQTKVERALMDFPAVTTAVSKTGRPAVAFDPMGQNLTDMFVGLAPR
DTWAFDSKAALVDSMRARVNQIPGANFAFTQPIALRLDEMVSGAKSEIALKIFGDDLDAL
RRLQSEAADAVSDIEGVADVLPSQIAGYGYVEVDIDRDRAARYGLSVGTIQRAIDVAIGG
EQLSTIREGDRRFALVGKFQAAARGSVESIRTLPLTTAEGARVRLQDVASVELTEAPAEV
SREQGKRKVTLGINLSGRDAGSFVAEAKKAFRSEVALPAGYLAEWGGQFENQERAQDRLL
LIVPITLAIVFVLLFMTFNSLGQAVLVFLNIPASVVGGVVLLWAMDLYMSVPASVGFIAV
LGIAVQNGVVMVSFIDNLRERGRPLAEAVRTGALLRLRPILMTTLTTLLGLLPLLVATGI
GANVQRPLAAVVVGGIFTLVPSTLLLLPTLYGWFNPEAQSERAIARAVEARDQAELRGSV
TA
Download sequence
Identical sequences D5HD58
WP_013062956.1.91540 gi|294508856|ref|YP_003572915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]