SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|342649739|ref|YP_004777024.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|342649739|ref|YP_004777024.1|
Domain Number 1 Region: 7-150
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.09e-59
Family Ribosomal protein S7 0.00000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|342649739|ref|YP_004777024.1|
Sequence length 157
Comment 30S ribosomal protein S7 [Salinibacter ruber M8]
Sequence
MSRNEAPEQRTTQPDPVYRDDMVSRFVNAIMRDGKKSLARRIVYDTFDVIEERTGEEEGL
EVFKKAVNNAAPLVEVRSRRVGGATYQVPTEVRPERRITLAFRWIIQYARARNEKSMVNR
LASELVDAARGEGGAVKKKDDTHRMAESNKAFAHFQF
Download sequence
Identical sequences Q2S3R8
309807.SRU_1031 gi|342649739|ref|YP_004777024.1| WP_011403791.1.91540 YP_445163.1.20240 gi|83815057|ref|YP_445163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]