SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294506946|ref|YP_003571004.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294506946|ref|YP_003571004.1|
Domain Number 1 Region: 85-353
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.06e-66
Family BC ATP-binding domain-like 0.00000549
Further Details:      
 
Domain Number 2 Region: 4-115
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.47e-49
Family BC N-terminal domain-like 0.0000148
Further Details:      
 
Domain Number 3 Region: 332-445
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.81e-46
Family BC C-terminal domain-like 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294506946|ref|YP_003571004.1|
Sequence length 455
Comment Acetyl-CoA carboxylase, biotin carboxylase [Salinibacter ruber M8]
Sequence
MSDIQKILIANRGEIALRVIRTCHEMGINTVAVYSTIDRDALHVRFADEAVCIGPAASGE
SYLRPDRLIAAAEVTGADAIHPGYGFLAENAEFSQICADNDIEFIGPSAETISLMGEKSK
AKEEMHKAGVPIVEGSDGTVGDLDAAYEIASDIGFPVMVKAVAGGGGTGMRLVREADGFE
RAFNGARSEADAAFGNPEVYIEKFVEKPRHVEIQVLGDGRGNVMHFGERECSIQRRHQKL
LEECPSPVVDEALREEMGAAAIRGAEAVNYEGAGTVEFLVGADRNFYFMEMNTRIQVEHP
VTEEVTDCDLVEYQIRVSMGETVDSEELPPMEGHAIECRINAENPFQNFSPAPGDITAFH
QPGGHGIRIDTAAYSGYRIPPTYDSMIAKLIAYGKTREQAIRKMRRALAEFVVEGVDTTI
PFHRQLMNDDRFQQGNFDTRFLDDFEMHAAPAEVA
Download sequence
Identical sequences D5H7P7
gi|294506946|ref|YP_003571004.1| WP_013061530.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]