SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507182|ref|YP_003571240.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507182|ref|YP_003571240.1|
Domain Number 1 Region: 795-1015
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.62e-51
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000831
Further Details:      
 
Domain Number 2 Region: 288-487
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.49e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.00005
Further Details:      
 
Domain Number 3 Region: 40-134
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.4e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0022
Further Details:      
 
Domain Number 4 Region: 181-265
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.31e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0071
Further Details:      
 
Domain Number 5 Region: 710-796
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.06e-16
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0054
Further Details:      
 
Domain Number 6 Region: 142-180,266-321
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000000000732
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0054
Further Details:      
 
Weak hits

Sequence:  gi|294507182|ref|YP_003571240.1|
Domain Number - Region: 558-643
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00424
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294507182|ref|YP_003571240.1|
Sequence length 1043
Comment acriflavine resistance protein [Salinibacter ruber M8]
Sequence
MALYDTSIRRPVATTMSFLVVIVVGAVSFYYLPVDLLPEIEYPQVSVTTSYPNVGPEEME
QIITDPVANAVSSVSNVERITSQSSEGSSRVNMEFGQGTDLNAAANDVRAALDRIRDDLP
VEAEPPSIRKFDPNSQEIVSISVESRRDLPSLTRLMERNLSKQFEQIPGVGTINVQGGIY
RQVQVNLNRERLMSYDLSAAQVQQSISSSNVALPGGNVKEGLKDLYVRTQGEYESLDEIR
NTVVTTANGTPVRVQDVAEVIDGYEDLGRIAELNGIPVLRLDIQKRSGANTVSVANRVRE
EVKRVNQTRSDLNLTVVSDQSDFIRKSINNVQSSAIWGSLLAILVLYLFLRNGSTTFIIA
LSIPISIIATFALLFFNDLTLNQMTFGGLALGVGLIVDNAIVVLENIIRQREENGRSLRE
AASMGTREVAGAILASTITTSVIFLPLVFARTTTASLFQSLALVVVFALACSLLVALTLV
PMMASRFLTVDAGEGDAAEDTSKSWFQRAFASLENQYSDAIRAALQRRWLVFGATGALLV
GALLLWPYVSVELAPQTDANQIDVDMQMAQGTNIAVVMKYLEELEQRVQPMLPQDEVENF
AKQVQPWGAEVEVQLKSAEERSINTFALADSIRSEVVGKVPGADLRVSAQSGLWILRRVF
SVGGGNEALRVQLRGYDLEQAQKLAQRVKQELETVEGVAGARSGRREGQPEQNIRFLRDK
ISSLGLTTQEVARAVQTNLGGSRAASYRTGGEQFPITVRLRPEDRLSVQDLDNVSIQTPD
GNSVPLSTLVTTQRGRGPTEIQRINGQRVTYISANLTSDAVLGEVVNQARQKVSTLSLPE
GFSVTFGGQYREQQKAQTDFLIAIFMALVLIYMVMAGQFERFLDPLIVMFSVPLVLVGVL
PTLVFTGTTVNIQSVMGFVMLIGIVVNNAIVLVDYINLMRRDRDLPLTEAVAEAGRLRLR
PILMTTLTTVLGLVPLALGIGAGAEIQAALARVVIGGLTASTLITLLLIPVAYVSLELTA
RTVRSKLPDWSWLPDSTVQPRRA
Download sequence
Identical sequences D5H8D3
gi|294507182|ref|YP_003571240.1| WP_013061714.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]