SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507187|ref|YP_003571245.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507187|ref|YP_003571245.1|
Domain Number 1 Region: 41-247
Classification Level Classification E-value
Superfamily MCP/YpsA-like 1.45e-45
Family MoCo carrier protein-like 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|294507187|ref|YP_003571245.1|
Domain Number - Region: 281-327
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0221
Family DNA-binding protein Mj223 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294507187|ref|YP_003571245.1|
Sequence length 331
Comment SMF protein [Salinibacter ruber M8]
Sequence
MTQVDGVGDQTAEAILTFDDRAAVRREMKRADDLDASLVSPWDARFPDRLREIYDPPAFL
WMRGTLPEDARPMVTVVGTRRCTDYGRTQAHHFGAELARRGFTVVSGLAYGIDTAAHKGA
LDAGGRTIAVLGSGVGRVYPKKHTALAERIAEHGAVLSEYGLDAEPDAPHFPERNRILSG
LALGTLVVESYAEGGALITARLALEQNREVFAVPGAITKDSSRGTNRLIQNGHAKLVMEI
EDLLEELPAVVVDDPDTVDAETISPGAGRDPTEELSGEAERLYDALSETPVHIDALCEET
GLSPSEALPTLLELEFQGWVRQLAGKQFRRS
Download sequence
Identical sequences D5H8D8
WP_013061719.1.91540 gi|294507187|ref|YP_003571245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]