SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507390|ref|YP_003571448.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507390|ref|YP_003571448.1|
Domain Number 1 Region: 19-135
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.65e-18
Family Antibiotic resistance proteins 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294507390|ref|YP_003571448.1|
Sequence length 138
Comment hypothetical protein SRM_01575 [Salinibacter ruber M8]
Sequence
MPADSPSSDVDAPTAVDVQLDHASVMTTDLDAAVSFYVDLIGLSLRTVEDDPVRDGRRRA
LLTDDHGQDVVELIEMEEMKHPSVPGRGGIHHLGFSLPSREWHSLRSRLDAADHAYEEVK
GRLFVRDADGLVLEIEEG
Download sequence
Identical sequences D5H8Z1 Q2S2S7
NYSGRC-FDAO-ABC43623 gi|83814116|ref|YP_445504.1| gi|294507390|ref|YP_003571448.1| WP_011404132.1.91540 YP_445504.1.20240 309807.SRU_1380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]