SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294507635|ref|YP_003571693.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294507635|ref|YP_003571693.1|
Domain Number 1 Region: 103-302
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.95e-58
Family BC ATP-binding domain-like 0.0031
Further Details:      
 
Domain Number 2 Region: 4-99
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.47e-17
Family BC N-terminal domain-like 0.011
Further Details:      
 
Domain Number 3 Region: 309-378
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.79e-16
Family BC C-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294507635|ref|YP_003571693.1|
Sequence length 379
Comment phosphoribosylaminoimidazole carboxylase ATPase-subunit [Salinibacter ruber M8]
Sequence
MSSTFPTIGILGGGQLGKMMAAEAVRMSVDARLLSPKEAGPMQPYTGARVGDWTDPDVLR
PFTADCDVVTVESEWAPADAAAEVLPDGAALWPSTQTLSLIKDKGVQKQHLADAGCPVPT
FACCETLDEALDAAEEFGYPVVLKQYRGAYDGYGNATAASEDELREAWPDLATEDGAMVE
TFADFARELAVQVARRPGGNQVVYPVAYTEQRDHRCHAVEVPADIDDAIADKARHIAQKS
VDAVEGVGLIAVELFEMPDGRVLVNELAPRPHNTGHYSIEGAATSQFENHVRAVLDWPLG
DPSLRTPVAVMVNVLGRREGTPPQTTGLPRALDTEGVTPHIYGKPDVRPGRKMGHVTALG
ADRADTRKRAEMAASAIEL
Download sequence
Identical sequences D5H9N6
WP_013062098.1.91540 gi|294507635|ref|YP_003571693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]