SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508753|ref|YP_003572812.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508753|ref|YP_003572812.1|
Domain Number 1 Region: 105-278
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-42
Family Bacterial dinuclear zinc exopeptidases 0.008
Further Details:      
 
Domain Number 2 Region: 309-381
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000302
Family HtrA-like serine proteases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294508753|ref|YP_003572812.1|
Sequence length 382
Comment aminopeptidase [Salinibacter ruber M8]
Sequence
MPGVPSPRRPLLPPRSTTCGSTWAISRPICCGGARRGPKGRASPHSTSCSASENWGSRRG
STAHGRSRLTSRTARIRTHRRDTGRRAPAAMSWRISTGGPGSRSPGDSLIHNGADDNASG
VAALLEVAHQLKNSDALSSNVLFVAFSGEELGLYGSKHFVDAMPVPPDQVRYMINLDMVG
RLGDSRRLVVSGTGTSPAWASALDAAAEATNITLAEDPSGLGASDHTSFYLDDIPAVHLF
TGAHDHYHTPGDDSHRIDYDGLHDVATFAVRLVEALGDDGDLPFTETDNEPQGRRTSFDV
TLGVMPDYTFDGTGMRIDAVTEDDGPAARAGLRAGDVVVRVGDVTVDDIYAYMDALGELA
PGDATTVVVKRGDQTLKAEVQF
Download sequence
Identical sequences D5HCV5
WP_013062872.1.91540 gi|294508753|ref|YP_003572812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]