SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294508767|ref|YP_003572826.1| from Salinibacter ruber M8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294508767|ref|YP_003572826.1|
Domain Number 1 Region: 3-269,297-398
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.64e-105
Family Amylase, catalytic domain 0.0000000174
Further Details:      
 
Domain Number 2 Region: 398-478
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000202
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294508767|ref|YP_003572826.1|
Sequence length 480
Comment glycosyl hydrolase family protein [Salinibacter ruber M8]
Sequence
MTTPDWAKHAVFYQIFPDRFARSGTVEAQDAGQLQPWGTPPVEQGFQGGDLYGIVDRLDY
LDTLGVTALYLNPIFASAANHRYHTYDYYEVDPLLGGTEALRALLDAAHARGMRVVLDGV
FNHASRGFWPFHHVLENGPDSPYVDWFKIEDWPLRPYASDQPHNYAAWYDIPALPELNTD
HPPVQDFLLDVARHWIEFGIDGWRLDVPREIETDGFWEAFRTVVKDANPEAYLVGEIWDE
APAWLQGDRFDGLMNYPLLDATLGFFGAGSLRDYSKAHLTFDPIDAPAFADELDRLLALY
EWEATCAQFNLLDSHDMARAQWILNDHTAAFRQAVLFLMTMPGAPCIYYGDEIGLSAAGD
PHCREAFPRDKDEWDTDLLSFYQAATALRHRHEVLRTGRIEVLHASGRTLVLRRTLADAT
ALVAFNAGADAAQVGLEAAALPTRPLSPAWPPSTDAPLPTPSSSLTLSLPPRETRVWTTD
Download sequence
Identical sequences D5HCW9
gi|294508767|ref|YP_003572826.1| WP_013062883.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]