SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284048187|ref|YP_003398526.1| from Acidaminococcus fermentans DSM 20731

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284048187|ref|YP_003398526.1|
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily YheA/YmcA-like 2.49e-29
Family YheA-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284048187|ref|YP_003398526.1|
Sequence length 111
Comment hypothetical protein Acfer_0823 [Acidaminococcus fermentans DSM 20731]
Sequence
MNVYDEMNNLCKAIKESHEYKVLVEAKGKLATDSSAESMVKDFLKQKQELEIAQYQGQKP
DDAKVKKMQDLYNVLQLNPVAGEYIQAYIRFQMMFGDLSKTLSDTLKEVMD
Download sequence
Identical sequences A0A1I5IG90 D2RJF9
gi|284048187|ref|YP_003398526.1| WP_012938200.1.22703 WP_012938200.1.49023 WP_012938200.1.88064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]