SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284048988|ref|YP_003399327.1| from Acidaminococcus fermentans DSM 20731

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284048988|ref|YP_003399327.1|
Domain Number 1 Region: 30-193
Classification Level Classification E-value
Superfamily SIS domain 2.41e-53
Family mono-SIS domain 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284048988|ref|YP_003399327.1|
Sequence length 196
Comment phosphoheptose isomerase [Acidaminococcus fermentans DSM 20731]
Sequence
MTSIGGKAQELIGARLLEHEKLVHKVMGSKRLLKAIEEAAGLISLTLASGGKVMFCGNGG
SAADAQHWAAEIVGRFQKERPGMAALALTTDTSILTAIGNDYGYDRIFARQVEGLGREGD
VLVGISTSGNSDNVLAAIETARAKGIRVIGFTAKGGGKMADLCDVLLDVPSVNTARAQEI
HEIMGHIICELVEDYA
Download sequence
Identical sequences D2RLR0
gi|284048988|ref|YP_003399327.1| WP_012938996.1.22703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]