SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269798385|ref|YP_003312285.1| from Veillonella parvula DSM 2008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269798385|ref|YP_003312285.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily YheA/YmcA-like 2.35e-28
Family YheA-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269798385|ref|YP_003312285.1|
Sequence length 121
Comment hypothetical protein [Veillonella parvula DSM 2008]
Sequence
MNYDKAHDLAHAMRESEEYKELMAAQEAVKADAVATGLVRTFMAQQMQWEYAKLSGAPEA
DELQKKQEELMPQIQENAAAAAYLQAQMRWSQISNDIYKIISEPITEGMKVLDHGEQQPK
H
Download sequence
Identical sequences A0A2I1TFN3 D1BNP8 D6KIW0
WP_008714407.1.43318 WP_008714407.1.68909 WP_008714407.1.96711 gi|269798385|ref|YP_003312285.1| 479436.Vpar_1327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]