SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269798903|ref|YP_003312803.1| from Veillonella parvula DSM 2008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269798903|ref|YP_003312803.1|
Domain Number 1 Region: 29-194
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.44e-34
Family Hypothetical protein TM0269 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269798903|ref|YP_003312803.1|
Sequence length 255
Comment Vitamin B12 dependent methionine synthase activation subunit [Veillonella parvula DSM 2008]
Sequence
MPIYNGMLPAIDKAEVKRYAGLRHAEDFPQNYVDEACKEIQLLATPRGVYQEYDYDAETK
TILSNPPLKIEGSIIEKHLEKSTKVYVLGVTVGEDVEIRSEQLFKQGNYTVGLLLDAAAT
TAVEQVADQVNEVINTIAKKQGYKPTWRFSPGYGNWPLEIQPELANIIKTELIGLQVTEN
YLLFPRKSVTAIIGLMPANEDIKTKRGCTSCSQQDCASRKLPEKATVNDQDRGEEEGSKT
TADISGIAMKGQPTE
Download sequence
Identical sequences D1BQ66
479436.Vpar_1849 gi|269798903|ref|YP_003312803.1| WP_012865039.1.68909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]