SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269137478|ref|YP_003294178.1| from Edwardsiella tarda EIB202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269137478|ref|YP_003294178.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.38e-39
Family Frataxin-like 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269137478|ref|YP_003294178.1|
Sequence length 107
Comment frataxin-like protein [Edwardsiella tarda EIB202]
Sequence
MNDSEFHLLADGLMQALEEALDACQSDADIDCETNGGVMTLSFENGSKIVINRQEPLHQI
WLATRAGGYHFDYRDGQWRCSRSGAPLHQVLNEACSAQAGVPVTLDR
Download sequence
Identical sequences A0A0H3DNX0 A0A1D7VD85 D0Z993
WP_012847000.1.32191 WP_012847000.1.39507 WP_012847000.1.79796 WP_012847000.1.82304 WP_012847000.1.83294 WP_012847000.1.91532 WP_012847000.1.93403 WP_012847000.1.93598 498217.ETAE_0120 gi|269137478|ref|YP_003294178.1| gi|470461272|ref|YP_007627583.1| gi|387866238|ref|YP_005697707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]