SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284041524|ref|YP_003391864.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284041524|ref|YP_003391864.1|
Domain Number 1 Region: 155-267
Classification Level Classification E-value
Superfamily OmpA-like 3.14e-29
Family OmpA-like 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|284041524|ref|YP_003391864.1|
Domain Number - Region: 71-181
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 0.0339
Family Succinyl-CoA synthetase domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284041524|ref|YP_003391864.1|
Sequence length 290
Comment OmpA/MotB domain-containing protein [Conexibacter woesei DSM 14684]
Sequence
MSARNRRGGRRRRGGGGHHGPDERWLITYADMLTLLLALFIVLYSISSLNTSKFEEMKTS
LRDAFSGKIISGGEGIIETGVSATRDTPTSIVPNITPPRVQIANPRDSTAAAALAARIED
NEFRRIKAQIDAYARTHGLRDQVEAVVARRGLVVRLLTDQVLFDSGFADLKSEGMPLLTH
VGNLLVIDRIHPILVEGHTDDVPISTSRFESNWELSTARATEVVRYLIDRGVPTRRFGAS
GYADLHPLGSNGTDRGRARNRRVEVVLQRLHLTSSQTTDAAPDPQEGLNP
Download sequence
Identical sequences D3F406
WP_012931542.1.44340 gi|284041524|ref|YP_003391864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]