SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284041528|ref|YP_003391868.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284041528|ref|YP_003391868.1|
Domain Number 1 Region: 189-372
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-54
Family Methylesterase CheB, C-terminal domain 0.0000346
Further Details:      
 
Domain Number 2 Region: 7-119
Classification Level Classification E-value
Superfamily CheY-like 4.13e-27
Family CheY-related 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284041528|ref|YP_003391868.1|
Sequence length 376
Comment response regulator receiver modulated CheB methylesterase [Conexibacter woesei DSM 14684]
Sequence
MSSATATRVVVADDSGLMRRVVTATLEHSGFTVVGAAKDGDEALALCERERPDAMTLDLA
MPGLDGIGVLRALRRQGERATPVVVVSAFSPAHGARAVDALAEGAFDLVAKPAVGDGIER
FTNELSDKVRLAAASRRGRTRPHGGRAGTGAAAAAGRAAAAPAAARPRTAAGSGAVRRAE
RRVRAHAGTRRVVVIACSTGGPKALAELVPALPAPLGAGTLIVQHMPPGFTNSLAARLDR
ASNLNVREAAGGEALDPKVALLAPGGAHLRLAEPSRVVSLSDAPEIGGLRPRADLTIADA
AKAFGERMVLVVLTGMGKDGLEGAREVRRRGGRVLVEAESTCTVYGMPRAVAEADLADEI
LPLHELPAAIAAEAGA
Download sequence
Identical sequences D3F410
gi|284041528|ref|YP_003391868.1| WP_012931546.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]