SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284041912|ref|YP_003392252.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284041912|ref|YP_003392252.1|
Domain Number 1 Region: 12-274
Classification Level Classification E-value
Superfamily Aldolase 1.29e-59
Family HMGL-like 0.000000558
Further Details:      
 
Domain Number 2 Region: 295-344
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.0000000000000051
Family DmpG/LeuA communication domain-like 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284041912|ref|YP_003392252.1|
Sequence length 349
Comment 4-hydroxy-2-oxovalerate aldolase [Conexibacter woesei DSM 14684]
Sequence
MSAAAQAPARLDVRVTDTCLRDGSHAVGHRFTREQVRDVVAALDAAGVPVLEVTHGDGLG
GSSYNYGFSGTPERELIATAVATARRARIAALMLPGVGTADDIRAVADLGVEVIRVATHC
TEADVAIQHFGLARELGLETVGFLMMSHSQPPDVLAAQARVMADAGCQCVYVVDSAGALV
LEQVAERVEAVGAELGDDAQVGFHGHENLGLAIANTVAAVRAGAAQVDGCTRRLGAGAGN
TPTEALAAVCEKLGIETGLDVLALADAAEEVVRPAMAAECTLDRGALLLGYAGVYSSFLK
HAERSAERYGVSTAQILLACGERRLVGGQEDQIIAIAADLAAARKEEAA
Download sequence
Identical sequences D3F7A6
WP_012931930.1.44340 gi|284041912|ref|YP_003392252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]