SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284042328|ref|YP_003392668.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|284042328|ref|YP_003392668.1|
Domain Number - Region: 133-225
Classification Level Classification E-value
Superfamily PKD domain 0.000549
Family PKD domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284042328|ref|YP_003392668.1|
Sequence length 956
Comment hypothetical protein Cwoe_0860 [Conexibacter woesei DSM 14684]
Sequence
MIQPSQSRRRVARAAALGAAVGVLAALPPSGAAAAKPAHKPGIMTVSSVRVGTSAAPVAI
KVRGLSRATKLRVWVNGRRADRAFHKVRGGTRVGALAAHDGLRFGRNRIRLRADRPDGYH
DIETRTVRLARSTPIASAGGDVTTTARTITVGPKRAALSGNDDDLTSQWRIVQEPAGSDA
ELRDADETRPTLTDAETGTYVLRHTVRDSDGSASNDTLTIGVRPDDPPIGAALHTIEPGT
ARITIDGRTVVDKGGLQYAVLERATRTVVKSGGFDPNKEGAASLKAVADGYAATDDHMMI
VSHWGARDPLAAERLNELLQRLGGAPLNKEEMTALYAGQPFTFIGLPGAPRGSAWTKIRF
EGGERDPDIDAYLQFNDATQLYDVVDLRHPTFDTRVPGKPAGTNTMRLNGSEQTARLDGG
VTAGIHVVALNDRLRVVENKLLATNGPGDDTGRQASMAGELRRIADIPGHPTVLLQTVGK
VKAAGAAWNDAGEQIARLGGNRWAFNELQGQDDAGYALVGRVDADLPAVDASRALDNDAS
RLVGSLARTRRNNFEPLVEATTGSVSTALTDVVSQAPEAFPAVNAAAMTYLAKRLDFCTD
QPTCDLRRLYWKQYGQKWLGKKSTLETSTYPGGNPGFSEQEFRATQAQLIDEVRALANIY
TYFEALKRPFEKAQRGTQVDLRDITNTVKRELNPGDGWNTTAWKLQLTSYAVKVGVFAGP
PASYVFEGMSAVFGLGAFLSNETGRATLADKVQTRADRLGDQLADSYDAAGNNIDTLALI
VASDWGKLRVAGSRVDNEWALPPRDGKALIELRRAARVMAAKTLITAAYPSLIMAKPPVG
DANGLECREPKTGKGPPPSSHPWSGMNANVQVKVADTIDGQGRWTRKGVFMAWSQSIWPS
AAVGDMLFKPLNARPTPGLGLSKLDLMQPFNFQEPLRLATDNATHCGSDIKPIWNR
Download sequence
Identical sequences D3FBC4
gi|284042328|ref|YP_003392668.1| WP_012932346.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]