SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284042802|ref|YP_003393142.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284042802|ref|YP_003393142.1|
Domain Number 1 Region: 9-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-61
Family G proteins 0.0000000569
Further Details:      
 
Domain Number 2 Region: 298-393
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.7e-36
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000606
Further Details:      
 
Domain Number 3 Region: 203-301
Classification Level Classification E-value
Superfamily Translation proteins 3.14e-31
Family Elongation factors 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284042802|ref|YP_003393142.1|
Sequence length 394
Comment translation elongation factor Tu [Conexibacter woesei DSM 14684]
Sequence
MAKEKFERDKPHVNVGTIGHIDHGKTTLTAAITTVLAEKMGGEARSFAEIDNAPEEKERG
ITIATSHVEYQTEQRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELLELVEVEVRELLSAYDFPGDDIPFITGSALKALE
GDEEYKAKIIELADALDSYIPEPERDLDKPFLMPVEDVFSITGRGTVATGRIEQGIINTG
DTVEIVGIKDTTNTVVTGVEMFRKILDEGRAGDNVGCLLRGTKREDIERGQVLCKPGSIT
PHTKFKAEVYILKKEEGGRHTPFFTGYRPQFYFRTTDVTGVSNLPEGVEMVMPGDNIAME
IELIQPIAMDPGLRFAIREGGRTVGSGVVTEVIQ
Download sequence
Identical sequences D3FEU3
gi|284042802|ref|YP_003393142.1| WP_012932818.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]