SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284043219|ref|YP_003393559.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|284043219|ref|YP_003393559.1|
Domain Number - Region: 4-46
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 0.0314
Family GMP synthetase C-terminal dimerisation domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284043219|ref|YP_003393559.1|
Sequence length 188
Comment hypothetical protein Cwoe_1757 [Conexibacter woesei DSM 14684]
Sequence
MTPREWQLIAVVIENCWKGEWDDARSASYFILLEPFDAADVERALHLLVRGGSPFIPAVA
EIVTAIESGRRVAAPTWHEALGHIRRVLPRHTRDHAAGITAFERIDPLLASFVATYGWRR
LALEPVDDPDHGGAVLRRLEHAYDAHVARQLERERHGLALEMVERRRLAGPRRLDVAALL
PSLPERAA
Download sequence
Identical sequences D3F209
WP_012933235.1.44340 gi|284043219|ref|YP_003393559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]