SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284043336|ref|YP_003393676.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284043336|ref|YP_003393676.1|
Domain Number 1 Region: 201-454
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.43e-53
Family N-type ATP pyrophosphatases 0.00000232
Further Details:      
 
Domain Number 2 Region: 24-244
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.04e-52
Family Class I glutamine amidotransferases (GAT) 0.0000149
Further Details:      
 
Domain Number 3 Region: 412-533
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.96e-47
Family GMP synthetase C-terminal dimerisation domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284043336|ref|YP_003393676.1|
Sequence length 533
Comment GMP synthase [Conexibacter woesei DSM 14684]
Sequence
MPTSATATVAAGGTAAEPNVDAEQVVVLDYGGQYSQLIARRVRECGVFSELLPHHVGAAE
VARRRPKGLILSGGPASVYADGAPRLEPELLQLGIPVLGICYGMQLLTTELGGEVQGAEV
GEFGRSKLTVKEPGRLLAGLPLEQTCWMSHRDTVFAPPPGFTALASSTESPVAALESVER
GIYGIQFHPEVVHTPYGQDIITRFLEEICGCARTWSASSVIDDQLARIREQVGGGRVICA
LSGGVDSSVAALLVHRAIGDQLTCVFVDHGLMRKNEGEQVITAFRDHYKVPLVAVDAEER
FLNRLRGVTEPEQKRKAIGDEFIRVFEEESAKLAEGGARFLVQGTLYSDVIESGGGTGAA
TIKSHHNVGGLPDDLQFELVEPLRALFKDEVRAVGAELGLPERLVWRQPFPGPGLAIRVV
GGEATRARLDTLRDADAILQDEIRRAGLYRELWQSFCVLPDVRTVGVQGDERTYGYVVVI
RAVTSDDAMTADWARLPYDLLEQIASRMINEIREVNRVVLDITSKPPGTIEWE
Download sequence
Identical sequences D3F321
WP_012933352.1.44340 gi|284043336|ref|YP_003393676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]