SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284044685|ref|YP_003395025.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284044685|ref|YP_003395025.1|
Domain Number 1 Region: 298-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.92e-47
Family Ribonuclease PH domain 1-like 0.00000603
Further Details:      
 
Domain Number 2 Region: 7-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.94e-45
Family Ribonuclease PH domain 1-like 0.00000997
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-28
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 144-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.27e-25
Family Ribonuclease PH domain 2-like 0.00075
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.83e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 
Domain Number 6 Region: 621-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.82e-17
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000199
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284044685|ref|YP_003395025.1|
Sequence length 761
Comment polyribonucleotide nucleotidyltransferase [Conexibacter woesei DSM 14684]
Sequence
MSDAVTRLSVEIGGKEISFETGRMAKQASGAVVVRSGDTMVLSTATAGNLRDVDFLPLTV
DVEERMYAAGKIPGSFFKREGRAGEKATLTARMVDRPIRPLFPKGWRRETQLVTLTLSVD
HEHPYDVLAMNGASAALMISDIPFPTPVGSVRIGKVDGNFVVNPNEEDLLENTDLDLIVA
GTEEAILMVEAGANEIPEAEILDALDIAHDAIKKLCRLQWELARKAGKPKTEVEVPQVDE
RLLRQLTRSHGRKLDRATAVVDKLERQDATKAVEAEVFARYAADEDDAETRAKVQLAFDK
LEKSLIRERIAIKKKRPDGRRADEIRPITIEVGVTPRTHGSALFTRGQTQALSTASLGTT
REEMRLDTLGLETRKYYFHHYNFPPFSVGEAGFMRGPKRRDIGHGALAERALVPMVPSTE
EFPYAIRVVSDILESNGSSSMASVCGSSLSLMDAGVPLKRPVAGIAMGLIKEGDDYIVLS
DIAGIEDHLGDMDFKVAGTSEGITALQMDIKITGVTFDILRDALAQAKEGREFILGKMAT
ALAKPREELSKWAPRISTVQIDPEKIGLLIGKGGETIRGLCEEFEAQIDVNDEGQVLIYA
QNGELGDALADRIRSMTKEVEIGDAFKGRVVKTTTFGAFVELAKGTDGLLHISNISPGRR
VDTVEEVINKGDEIDVRVVEVDRERGRIGLRLAEDPDIAGKTVEELAAISAGNGGGGGDR
GGRPDRGARRGGGDRGGRRDDRPGGGGRGGRGGRDRDPDRS
Download sequence
Identical sequences D3FE34
gi|284044685|ref|YP_003395025.1| WP_012934701.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]