SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284044780|ref|YP_003395120.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284044780|ref|YP_003395120.1|
Domain Number 1 Region: 111-382
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.66e-26
Family Integrin alpha N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 630-728
Classification Level Classification E-value
Superfamily PKD domain 0.00000131
Family PKD domain 0.012
Further Details:      
 
Domain Number 3 Region: 483-539
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000133
Family Cadherin 0.081
Further Details:      
 
Domain Number 4 Region: 36-95
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0000418
Family Integrin alpha N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284044780|ref|YP_003395120.1|
Sequence length 935
Comment Ig family protein [Conexibacter woesei DSM 14684]
Sequence
MRQSLALAVALLLGCSATALAVEPSIAPGTTSPAFLAGEHAGDGLWQATAAGDVNGDGRE
DLVLSYSVIDGARPMSARAYVVFGDGTDAPVDLAALGTRGFAIDGPDDAAWSFSAVPGGD
VNGDRLDDVLVSAAFASTPSRTRAGRVFVVFGADGADATTTVDLDVLGERGYEVYGRGAQ
AFAGSASSVRDLDGDERDELLVHESNPDRATLLFGKATTTPVDLGAIGAGGYRIEAPAVP
GIDAVSGVGDVNGDGLEDLAFSGACGGGSCASGRTWVSFGKRDLDPVDLDALGGGGFSLT
GTDLAGVGRAGDVNGDGRADIAVSDYNNGRAFVVFGRAATSPLSFAALGSAGFRIDRVDG
VLKGVGDVDRDGLDDLADSSSFGSGGMIIFGKASSAPVDAGNLLDAGILLGGRTAGVGTT
SDFGAGPRLFAAYFLDSPLGRAGAGSVRLFTPPAPSFELAGPLAYAAGGAIAPVAPMEQR
RASPLSYSVAPALPDGLTLDPASGTIAGTPRQATAARPYTVTGRDRLGTTSRTISIRIDD
PSYATLAPATAATTASRPLFAWSRASAPDDSEPVTAYTLMLDGAAYATLAAERCGERCEL
AAPSPIADGAHRWHVETTARDGHVRRTAAAELTVVDPPTARLALTRGAVHTGEPVGLDAS
SSSDPNGPIVRYEFDLDGDGRYEIDAGRDPRRVISYPSIGDRRVAVRVTDAGGSVAETSA
SLHVSPAPPAGELGVSVNDGAIATNDPNVTISLVWPRLADTALISNDGGFGAAGSTRELG
LVARVPWRLASSGPERLPKIVYLRFRGGESGRETYTDDIILDQRSPQVVSAALAAAAGSP
ATASARRRGRSRAKKATLRVSVKDDNSGLRRVEVATRRGGRPIATKQLAPANHKGRRAAS
AQLRVPSGRGRLYVRVTDVAGNVSGWKAAARKRGR
Download sequence
Identical sequences D3FF28
WP_012934796.1.44340 gi|284044780|ref|YP_003395120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]