SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284045279|ref|YP_003395619.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284045279|ref|YP_003395619.1|
Domain Number 1 Region: 8-122
Classification Level Classification E-value
Superfamily DsrEFH-like 1.03e-17
Family DsrEF-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284045279|ref|YP_003395619.1|
Sequence length 123
Comment hypothetical protein Cwoe_3827 [Conexibacter woesei DSM 14684]
Sequence
MTERNADVVINLATGHEDAERVTVAFLVATAALAKGRQVTMFLTKEAVRLGLPGYGEAIE
VSGAPPVARLLSQFADGGGELLVCPICFSGRQLDEAALVPNAVLGGATPLFDRIGDGATV
FSY
Download sequence
Identical sequences D3F2H8
WP_012935295.1.44340 gi|284045279|ref|YP_003395619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]