SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284045629|ref|YP_003395969.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284045629|ref|YP_003395969.1|
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.47e-20
Family DNA-binding N-terminal domain of transcription activators 0.0029
Further Details:      
 
Domain Number 2 Region: 119-273
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000000000628
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284045629|ref|YP_003395969.1|
Sequence length 279
Comment transcriptional activator ligand binding domain-containing protein [Conexibacter woesei DSM 14684]
Sequence
MKPMMTVGQFARMTRLSAKQLRSWDGLGLLAPAQVDPDTGYRYYHPRQARTAVTIALLRS
LDVPLASIRELLVADDEGAERLLSEQRERLQAELVARERALRALARLTADRELMPYEVST
ATLPPRRLLGLRGTTTAERLHRDAAALVEQLLRALPWAAAPGAPPLVGLYPLDLDGDVAF
AVGVDPAASAAPEAAGAAASRPDGIVPIELPGGAIARVTHVGSYDELPLAYFPLLAWLQE
RGHPAAGPVRETYLDDPSEVEPTRLRTEVSIPLTDPEDR
Download sequence
Identical sequences D3F5P5
gi|284045629|ref|YP_003395969.1| WP_012935645.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]