SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284046403|ref|YP_003396743.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284046403|ref|YP_003396743.1|
Domain Number 1 Region: 855-1146
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 2.28e-26
Family Nitrous oxide reductase, N-terminal domain 0.045
Further Details:      
 
Domain Number 2 Region: 193-412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-18
Family Clostridium neurotoxins, the second last domain 0.066
Further Details:      
 
Weak hits

Sequence:  gi|284046403|ref|YP_003396743.1|
Domain Number - Region: 800-883
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 0.00392
Family Hedgehog (development protein), N-terminal signaling domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284046403|ref|YP_003396743.1|
Sequence length 1349
Comment 40-residue YVTN family beta-propeller repeat-containing protein [Conexibacter woesei DSM 14684]
Sequence
MSVAAVTMGRRLTEPFARGSDTLELTLSAIARDAARATVDPYDFAEHAARFDRPPQPAYV
LVAQRDVEVETNVTLAWRGGRAEVRVPAGALAGTSFAIPLGAAASPPPGPFLRTLTMDPP
APGGDPAACWSITALLGNLAKLLWVAGWERDRVRRELDRVTEQRSRASALGRALDLLGAD
LGVPRFVPLAYTYDDDTLALLHLDDPVRPGPGQPDAEDRAGRYRGVALAHHGVNTGGAAQ
PAVPGRFGGGFAFRAPAAELLIADHADLALDAARSTTVECFFKPDPGADGHLLSKQARPG
AANDPGWALTLGEFGRGLARNVRWQCSDGRAAVAVFADVSLDTERFHHLAGVVDRAAGEL
RLHVDGALRATAPLGRTGALTSAAGLRLGRHGGTGAAGVLDELRVSAAARTSFAPALGES
DGSYRRRLGVFERWTLPSPAAIEAALNEAVGEIAGDPAALVVDDTPATLVTGAAPVRIVP
ASIPPGGHVDALGRRRTREQDAIGTVNDDERRLGSAWLTTFADARADVAAAPARVLAAGE
EPPDPSRMHGRAARSLTALLDRLASAREPGRVVVRSAFDPDPPDLHAPDPSRLDPGTPEG
RAAAARAAAARAADPRTVGRALLLEHDGLGLARLAAHAHAAGFDYVRHRGDLRGVLASVR
AEERLTIAAAPAPAAGSGVDAVVGGTLDLTFAPAPPAADVRVEWVTIPCGRGRATFETAA
TGASVRLRATAPGVLTVRVEAIWHGATASGTRTLRIGPADLADGASIAADGEQGVAAAIA
DGTDPPPFLHAVHLLHVEEKPAAFDAGDNPHRMQRGTAARLKRLLELLEQSRARGTLRVH
EAWDPAGRDLRARGRRLLVSHSALAAGALAARAHAAGFAYVARSGARVELRHGEEELLDV
TAPPELAEEQAGDVAIAQGADARSVAVTGDAVFSVNAGTDSVSELDPKTGAVRRAIKVGH
RPVAVAVDPSARRLYTADESSATVSVVDLASGALLAPIATGQAPADLLHHPRLARLYVAC
RGDATVRAIDTGRATQVGQVAVGAGRPRLALARDGRLWVASDGEAAARLLAADPLAPAGQ
LALPSRPADLVVAAGTDVGWVALPAVTSVSVLRTDVPSVTATVALAERPTALAVADGDAG
LYALGRRESGAALGFALDLAAVEQTRFPLPRGSVRLVAAGAGRRLYAPVTGVGVATFERG
ARASVALIATWQLGTGLGEELRWIARPFGEARGRFAGLSRPDTRLTGERAGPLLARAVAS
LGDHGPPYTFEVLLKPALDRPRTLIRKDQYDLLMNVLNLLHPIGVEVRTRRIREHVLEVR
EGLLEAFPDYTYPNFRVSGPAPVAPGQEA
Download sequence
Identical sequences D3FC73
WP_012936419.1.44340 gi|284046403|ref|YP_003396743.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]