SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284046976|ref|YP_003397316.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284046976|ref|YP_003397316.1|
Domain Number 1 Region: 20-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.44e-54
Family G proteins 0.000000717
Further Details:      
 
Domain Number 2 Region: 330-432
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.23e-31
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00009
Further Details:      
 
Domain Number 3 Region: 237-326
Classification Level Classification E-value
Superfamily Translation proteins 4.48e-18
Family Elongation factors 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284046976|ref|YP_003397316.1|
Sequence length 437
Comment sulfate adenylyltransferase, large subunit [Conexibacter woesei DSM 14684]
Sequence
MAATATMNGRPGDGGVETTELLRFATAGSVDDGKSTLIGRLLHDAKSILADQLAHVKETS
ERRGDGELNLALLTDGLRAEREQGITIDVAYRSFQTDKRRFIIADCPGHEQYTRNMVTGA
STADLSLVLVDARNGLVRQSRRHAAISALLRTPHLVVCVNKMDLVDYDESVFDAIVADFK
QWSAAFDGFADITFIPISALKGDNVVDRSENMPWFDGEPLLHHLETVQIAGDRNLDDWRF
PVQWVVRPQNDEQHHDYRGYAGQVAGGVLTPGEEVVVLPSGRTTRLAAIDTIDGPLDVAF
PPQSVTLLLEDDLDVSRGDLIARPSDAPTVARELEAVVCWMADAPLKPGGRYAIKHTTRA
VRGIVDGLDWRLDVETLDRVPQADSLSLNEIGHVKLRLSAPLAFDSYERNRDTGSFILID
ESTNDTVGAGLIVVPQD
Download sequence
Identical sequences D3F0K7
gi|284046976|ref|YP_003397316.1| WP_012936992.1.44340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]