SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284047274|ref|YP_003397614.1| from Conexibacter woesei DSM 14684

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284047274|ref|YP_003397614.1|
Domain Number 1 Region: 350-577
Classification Level Classification E-value
Superfamily PHP domain-like 1.18e-52
Family PHP domain 0.00065
Further Details:      
 
Domain Number 2 Region: 164-324
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.38e-33
Family DNA polymerase beta-like 0.0075
Further Details:      
 
Domain Number 3 Region: 5-86
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00000000000222
Family DNA polymerase beta, N-terminal domain-like 0.0035
Further Details:      
 
Domain Number 4 Region: 83-141
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.000000288
Family Achaeal helicase C-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284047274|ref|YP_003397614.1|
Sequence length 592
Comment PHP domain-containing protein [Conexibacter woesei DSM 14684]
Sequence
MADPTNSEIAAAFDELGDLYELDGAIIHRVVAYRNAAKVVRDASVSVAALTRDGRVTELP
GIGATLETKLVALVETGDIPQAARLRAKFPAGLLEMTRLPGLGPKRARRLYEELGVDSLQ
SLETAARQQRIRDLKGFGVRAEENFLAAIARANADAADGKTGGRFVLDRALAIAEPLLEL
LRAHPTSHRVELAGSARRWADSVKDLDIIATADDPRALAEALTASDLVESIAGVGDAGAR
VRTHSGMGVDLKVVAPDQFGNLLQHFSGSKEHNMALREAAVKRGLHVSEYGVLDDATGET
LRCATEQEVYAELGYAYIEPELRENRGELRAALLDGGSGLPELIREEDVRGDLHSHTTAS
DGRNEIEEMAEAAQALGYEYLAITDHSASHGFGDEVSAEQLEIQIERIHAANAAFPGIEL
LAGSEVNIMPDGSLDYPDELLARLDWVIASVHSSFRIDERAMTERVVAAIEHPWVDAIGH
LTGRKIEARPPYAIDVERVIEAAARTGTMLEINAAPDRRDLNDVHARAAAQAGVRILVNS
DAHRTRTLASSRRYGIATARRAWLTAEQVANTRGWAQFAPLRKRAGTVSPPG
Download sequence
Identical sequences D3F2V8
WP_012937290.1.44340 gi|284047274|ref|YP_003397614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]