SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291287994|ref|YP_003504810.1| from Denitrovibrio acetiphilus DSM 12809

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291287994|ref|YP_003504810.1|
Domain Number 1 Region: 20-260,436-495
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.25e-45
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00061
Further Details:      
 
Domain Number 2 Region: 285-425
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.97e-20
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291287994|ref|YP_003504810.1|
Sequence length 501
Comment fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein [Denitrovibrio acetiphilus DSM 12809]
Sequence
MRKSLSVIAFIMLTVCNLYAADKIYNVDVCVVGAGAGGTTAAVSAQEAGLSTVLLEKMPF
TGGAGNFMEGSFAAESFMQKKAGIKLTKEQAFNNIMHYHHWMPNAKLVKAFVDESSKTIQ
WIWDHGVHFEEVKSAFKDNPIRTWHIYPTAGAYYIRTMVNTYLDNGGTLLLETPGKQLIF
DRNGKISGVLAQNQDGDLIQINAKYVILATGGYANNVEMIVQYGGPESVPTGPEGREGDG
INMALSAGAALDGMGPLEVNGAMLIAPGEAICNGNNAELRAMFRQSLLYVNHKGERFFNE
EVTIDWPMASNAIARGGKYTYVVFDADTLKEFQTSGYLNPCGNWIKRGQPMKRFDELFPE
NVAKGYAYEGATLEEVAKKAGMDPAVLNKTAADMTKFAKEGYDEQFGKNKRFIRSVAKGP
FYILKGQIHHLTTLGGAKVTEHLQVVDEKEQTIPGLYAIGHDAGGLYGDSYDLTIGEGTS
SAFAINGGRLAAKDIINKVSK
Download sequence
Identical sequences D4H263
gi|291287994|ref|YP_003504810.1| WP_013011358.1.70151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]