SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269118661|ref|YP_003306838.1| from Sebaldella termitidis ATCC 33386

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269118661|ref|YP_003306838.1|
Domain Number 1 Region: 147-488
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.17e-115
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000659
Further Details:      
 
Domain Number 2 Region: 7-140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.86e-33
Family Anticodon-binding domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269118661|ref|YP_003306838.1|
Sequence length 494
Comment lysyl-tRNA synthetase [Sebaldella termitidis ATCC 33386]
Sequence
MSEQQINEKSIIGEKLKKVEELKALGIEPYGRKFDKKDDIEDILKFDETSDKTFKTAGRI
VAFRRMGKNGFGHIQDLSGKIQYYVKKDTVGEENYEIYKKLGVGDFIGIEGTLFRTQTGE
LTLRASSFEVLSKNIRPLPEKFHGLTDVETRYRQRYVDLVMNNDVKETFITRFKILRFIR
NFLENKGFLEVETPMLHPIAGGANAKPFITHHNALDMDFFLRIAPELYLKRLLVGGFEKV
FEINRSFRNEGTSIKHNPEFTMLELYQAYADFEDIMNLTEELVSSLVEELFGTTKLTYQD
TEIDFTRPWKRIKMKDAVKDATGFDLDSINSDEEALNLVKSMNIPLEKDKAYTKYGLLNL
LFEEKVEATLMNPTFITEYPKEISPLSKNKKDSVDFVDRFEMFIYGREHANAFSELNDPV
EQKERFDAQEKMKEAGDDEAHETDLDYIRALEYGMPPAGGLGIGIDRLTMLLTDSFSIRD
VLLFPALKKEDFEL
Download sequence
Identical sequences D1AIU5
WP_012859507.1.35130 526218.Sterm_0019 gi|269118661|ref|YP_003306838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]