SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269119306|ref|YP_003307483.1| from Sebaldella termitidis ATCC 33386

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269119306|ref|YP_003307483.1|
Domain Number 1 Region: 10-237,408-478
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.64e-105
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00036
Further Details:      
 
Domain Number 2 Region: 464-569
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 5.44e-28
Family Anticodon-binding domain of Class II aaRS 0.0017
Further Details:      
 
Domain Number 3 Region: 218-373
Classification Level Classification E-value
Superfamily YbaK/ProRS associated domain 1.15e-24
Family YbaK/ProRS associated domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269119306|ref|YP_003307483.1|
Sequence length 571
Comment prolyl-tRNA synthetase [Sebaldella termitidis ATCC 33386]
Sequence
MRLSKAFVKTYKEAPKEAEVISHKLMLRASMIKRLASGVYSYLPLGNRVLKKVENIVREE
MDKSGAQEVFMPVLQPADLWKESGRWIAYGPELMRMKDRHEREFALGPTHEEVVTDIVRN
EINSYKDLPMNLYQIQTKFRDEIRPRFGLMRGREFIMKDAYSFHTTHESLDEEYLNMKTT
YENIFTRCGLDFRAVEADSGSIGGDVTHEFMVLAESGEDDVLYCDSCDYAANKEKATSKA
DFKESDEEAKSIELVETPNTWTIEDVAAFFNIPTSKTVKAIVLKEAFGENDKYYMALIRG
DYEVNTIKVKNLVNAAVELEMINDSDMEKLNLVKGFIGPVGLNNENIKIVMDESVKFMKN
FTLGPNKKDHHYINSNISDFKYDMTGDIREAKEGEKCPRCGGTLKIARGIEVGHIFELGT
KYSEAMKANVLDENGKQATLKMGCYGIGVSRIMSAAIEQNYDENGIIWPVNIAPYEVDVI
IPNIKDKDQVRVAEDVYQLLKDHNIDVILDDRDERAGFKFKDADLIGFPMKIITGKSIAE
GKVEVKDRKTGNTEIVEIGTLLDYVKNHLGK
Download sequence
Identical sequences D1APX4
gi|269119306|ref|YP_003307483.1| WP_012860148.1.35130 526218.Sterm_0680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]