SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269120654|ref|YP_003308831.1| from Sebaldella termitidis ATCC 33386

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269120654|ref|YP_003308831.1|
Domain Number 1 Region: 41-101
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000563
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  gi|269120654|ref|YP_003308831.1|
Domain Number - Region: 176-237
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00445
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number - Region: 107-165
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00458
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269120654|ref|YP_003308831.1|
Sequence length 330
Comment PASTA domain-containing protein [Sebaldella termitidis ATCC 33386]
Sequence
MAGRIRINYIKFIIFVISLAVIIIFGRDVFVRRFFNEQKSEVPNVMNLDVKDAEKYLKEA
GLKVKINSSNSEKVGFNKVFIQYPEAGKIVKTNRTVQIWVNNGKGKEVPNIEKMELLEAK
SILQNSDIQIEKIDYQPSDAKFNTIISVYPAPGTKLDPNQKISLLVSSRKILDASVMPNL
IGLDLNDAQTLLVQLGLKAGKISRANDDTLPVNAIISTNPAPGAKIEKGQAVSIVINSGP
APRKAEPTIEDIIKQNSDENVTNQNVEDIINQTMEKIDEKSTKPAAPPANNNAKPDNSSG
TAPAGGESQPKQAPQPKKPEGSGTPAPAQD
Download sequence
Identical sequences D1AJL2
gi|269120654|ref|YP_003308831.1| WP_012861494.1.35130 526218.Sterm_2045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]