SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269121090|ref|YP_003309267.1| from Sebaldella termitidis ATCC 33386

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269121090|ref|YP_003309267.1|
Domain Number 1 Region: 94-460
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-97
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000458
Further Details:      
 
Domain Number 2 Region: 10-101
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.79e-18
Family Anticodon-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269121090|ref|YP_003309267.1|
Sequence length 462
Comment asparaginyl-tRNA synthetase [Sebaldella termitidis ATCC 33386]
Sequence
MLLEIREIYKKHAELLNKELELNGWIRKRRDQKNFGFLEVNDGTFFNGIQVVFDDSLSNF
DEISRLSISSSVHVKGVLVQSEGKGQTFEIKAKEITIYNKADLDYPLQNKRHTLEYLRTI
AHLRPRTNTFMAVFRVRSLMSYAIHKFFNERGFVYVHTPIITGSDTEGAGEMFQLTTLDL
KDIPKNDKGEVEYKDDFFGKQANLTVSGQLNVETFCMAFKNTYTFGPTFRAEKSNTPKHV
SEFWMMEPEIAFADLDVNMDIAEDMMKYIIRYVLENAPEEMQFFNQFIDKTLLDRLNGLV
NSEFGRVTYTEAIEILKKADKKFEYPVEWGIDLQTEHERYLAEEHFKKPVFVTDYPKDIK
AFYMKLNEDGKTVRAMDLLAPGIGEIIGGSQREDNFEKLEQRIKDMNLNEKDYWWYMELR
KYGSVPHSGYGLGFERAIMYVTGMLNIRDVIPFPRGPKSLEF
Download sequence
Identical sequences D1ALJ3
526218.Sterm_2483 WP_012861930.1.35130 gi|269121090|ref|YP_003309267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]