SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269121339|ref|YP_003309516.1| from Sebaldella termitidis ATCC 33386

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269121339|ref|YP_003309516.1|
Domain Number 1 Region: 2-240
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.46e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000598
Further Details:      
 
Domain Number 2 Region: 241-463
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 4.71e-58
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000112
Further Details:      
 
Domain Number 3 Region: 548-703
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.89e-49
Family AlaX-like 0.014
Further Details:      
 
Domain Number 4 Region: 455-547
Classification Level Classification E-value
Superfamily Translation proteins 1.91e-16
Family AlaX-M N-terminal domain-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269121339|ref|YP_003309516.1|
Sequence length 870
Comment alanyl-tRNA synthetase [Sebaldella termitidis ATCC 33386]
Sequence
MTGNEIRKSFIDFFKSKEHKYFESASLIPDDKTLLLTVAGMVPFKSFFLGEKEAPFKRIT
TYQKCIRTNDLENVGVTTRHQTFFEMLGNFSFGDYFKREAIFWSWEYITEILKLDSEKLW
VSVFLDDDEAYDIWNKEVGVPEERIVRLGEDDNWWAAGPIGSCGPCSEIYIDLGEKLGCG
NLDCKPGCDCDRYLEIWNLVFTEWNRLEDGSLIPLPEKNIDTGAGLERIAAVMQKKESNF
DTDLFIPIINETEKILEVERNNKTDKALKIIADHVRAAAFLIGDGVLPSNEGRGYILRKL
IRRAFGVASTIKERIFEKEDIFLYRLVPVVAEIMKEAYPEMESKIDYIEKVMKIEEEKFT
VTLKNGVEILKEEVEKLKKDGKDKFPSEISFKLYDTYGFPFELTKEVLEYEEIEVSEDEF
LEKLEEQKIRSKSSKETISDMIKDEFIDEFYEKHGKTKFIGYEEKEAKAKILHINKSHGS
SNYEIIFDQTPFYAESGGQVADTGIINSQDLFEGKVVNVIKKKDVYIHEVELIKGIIPKI
GDELTLKIDKFKRKDTQRNHTATHILHKALREVLGSHVEQSGSLVDSERLRFDFSHYEAV
SPEQIEAIERIANQIVLENIELAVYNEDIETAKARGAMALFGDKYGDEVRVVEIPQFSIE
LCGGTHVKSTGEIGLINIESESGIASGVRRITATTGYKSLDFVNTLEESQKELAKSLKVE
EKKIKEAVEKLKESYKDLEKDYNDLQMKFLKYEINDLMGHIIEINGTKVLIKGFENKDNE
ELKEIVDRVKDKLKSGVVLIGANNGNAMFLAGVSKDLTGKIKAGDIVKEVSKIANGNGGG
RPDFAQAGGKAGEKVYEALEHGKRYLEEKL
Download sequence
Identical sequences D1AML1
gi|269121339|ref|YP_003309516.1| 526218.Sterm_2740 WP_012862179.1.35130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]