SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269122523|ref|YP_003310700.1| from Sebaldella termitidis ATCC 33386

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269122523|ref|YP_003310700.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.37e-129
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269122523|ref|YP_003310700.1|
Sequence length 289
Comment glycyl-tRNA synthetase subunit alpha [Sebaldella termitidis ATCC 33386]
Sequence
MTFQNIILTLQKFWGDKGCVIGNPYDVETGAGTFNPDTFLMSLGPEPWNIAYVEPSRRPK
DGRYGENPNRLYQHHQFQVIMKPSPENIQELYLESLSALGIDPKEHDIRFVEDNWESPTL
GAWGLGWEVWLDGMEVTQFTYFQQVGGIELDITPVELTYGLERLALYLQNKDNVYDLEWT
EGVRYGERRYQYEYEMSKYSFEVSDSDMNFKLFDMYEKEAKNCLDHNLVLPGYDYVLKCS
HVFNNLDARGSISTTERMSYILRVRDLAKICAEQFVEVRKKLGFPLLKK
Download sequence
Identical sequences D1AGP9
gi|269122523|ref|YP_003310700.1| WP_012863344.1.35130 526218.Sterm_3936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]