SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269122683|ref|YP_003310860.1| from Sebaldella termitidis ATCC 33386

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269122683|ref|YP_003310860.1|
Domain Number 1 Region: 94-339
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.71e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000067
Further Details:      
 
Domain Number 2 Region: 15-99
Classification Level Classification E-value
Superfamily tRNA-binding arm 3.92e-18
Family Phenylalanyl-tRNA synthetase (PheRS) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269122683|ref|YP_003310860.1|
Sequence length 339
Comment phenylalanyl-tRNA synthetase, subunit alpha [Sebaldella termitidis ATCC 33386]
Sequence
MREKLDKLKEQVTEKLDQINSLENLDELRIAILGKKGELTSIMKEMGNIAAEKRAEFGKA
ANEVKEKIMENFDIKLAALKTRIKEEKMKTEVLDITLPGKKQNVGTLHPITQTMGMLRGI
FLEMGFDVMDGPEIEQTYYNFDALNFPKDHPSRDLQDSFYIEDDLLLRTHTSPMQIRYML
EKKPPFRMVSLGKVYRSDYDITHTPMFHQMEGLMIGEDVSFANFKALLTSMVRRLFGEDR
AVRFRPHFFPFTEPSAEMDVECGVCHGKGCRSCKNTGWLEILGSGMVDPNVLKEVGIDPT
KYQGFAFGMGMERVAMLKFGIDDIRAYYENDVRFLDQFK
Download sequence
Identical sequences D1AGH7
526218.Sterm_4097 gi|269122683|ref|YP_003310860.1| WP_012863504.1.35130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]