SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269121223|ref|YP_003309400.1| from Sebaldella termitidis ATCC 33386

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269121223|ref|YP_003309400.1|
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.48e-54
Family PP-loop ATPase 0.00012
Further Details:      
 
Domain Number 2 Region: 358-423
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000863
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269121223|ref|YP_003309400.1|
Sequence length 442
Comment tRNA(Ile)-lysidine synthetase [Sebaldella termitidis ATCC 33386]
Sequence
MLDFRITDKLKKIIGKYELLKKNDKVLIAFSGGPDSVFLFHCINFFRESLGLELELVYVN
HKLREDADEDIKFVKEFAEKYEVRYHIREADVKETAVREKISEEEAGREERYRIFFDIMK
ENNIDKIATGHNLDDNIETFIFRLLRGTALNGLKGIPVKRGAIIRPILEFRKDYILEVLD
GADEEYRLDSTNFETKYTRNKIRNLIFPLFSEVNPLFREKIAGLIEEINNFEDIEKSKEA
VLWLSDLRKMDKTMQNKRIFDLISMYDIEINREKIRQIGELINSKGNKEINLGNNFILYK
NYDKLEVIFQNEYVPLPEELILEEGIMTEWGDYLLEVTKRDIKESSRENGKIIFLGDKTN
IKVRSRKEGDRIYLKNLGYKKIKKILIDEKIEKKERERIPVIELDNEIAAIGDIKISGKL
ELSRNAVSKEQMKLIIRRKNAK
Download sequence
Identical sequences D1AM95
WP_012862063.1.35130 526218.Sterm_2624 gi|269121223|ref|YP_003309400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]