SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289165652|ref|YP_003455790.1| from Legionella longbeachae NSW150

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289165652|ref|YP_003455790.1|
Domain Number 1 Region: 12-115
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000242
Family SH2 domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289165652|ref|YP_003455790.1|
Sequence length 167
Comment hypothetical protein LLO_2327 [Legionella longbeachae NSW150]
Sequence
MEAMQKNELNSKIPIIFGLINSYQIHNLLEQHNAKTKESKAVFLIRDSSTYPGLLTISYY
CQEQDIVKHIRFGLTDKGWKTAPKPPHEPLKSDSPEIKEKYTLDKIKFERKMKQFINTAK
KLFEQHIRAESFKTLIMELKIHEFNLEGLIKPTRSQASQEKHFTDYV
Download sequence
Identical sequences D3HJY4
WP_003636113.1.28247 WP_003636113.1.35775 WP_003636113.1.41439 WP_003636113.1.55568 gi|289165652|ref|YP_003455790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]