SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261854793|ref|YP_003262076.1| from Halothiobacillus neapolitanus c2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261854793|ref|YP_003262076.1|
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.77e-19
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 63-153
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 8.85e-19
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261854793|ref|YP_003262076.1|
Sequence length 155
Comment asnC family transcriptional regulator [Halothiobacillus neapolitanus c2]
Sequence
MTLDRYDRQILTLLQENGRLSNQELADAIGLSASPCLRRVRALEESGLILGYRALLDARK
LGLNLVALLHISMDQHTPERFAHFEQQVARLPEVIECLLITGQTADYQLKVIVTDMDAYQ
ILLLNQITRIEGVTGVQTSFVLRRVLDKTSLPIPD
Download sequence
Identical sequences D0KWN2
WP_012823065.1.355 555778.Hneap_0165 gi|261854793|ref|YP_003262076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]