SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261856146|ref|YP_003263429.1| from Halothiobacillus neapolitanus c2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261856146|ref|YP_003263429.1|
Domain Number 1 Region: 55-464
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.29e-133
Family TK-like PP module 0.000000000122
Further Details:      
 
Domain Number 2 Region: 470-697
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.28e-89
Family TK-like Pyr module 0.000000151
Further Details:      
 
Domain Number 3 Region: 704-883
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.51e-52
Family Transketolase C-terminal domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261856146|ref|YP_003263429.1|
Sequence length 889
Comment 2-oxo-acid dehydrogenase E1 subunit, homodimeric type [Halothiobacillus neapolitanus c2]
Sequence
MTAYQDQDPQETREWLEALEAVVAVEGTDKARHLIGNLIEAARKHGIDTPYSATTPYINT
IPTEKEPTYPGDRQLEQRLRALIRWNAMAMVARANKHTSVGGHIATFQSSATMYEVGFNH
FFKGHDHPDGADMVFFQGHAAPGMYARAFLEGRISEEQLANFRQEAHLDGVSSYPHPWLM
PTFWQFPTVSMGLGPLQAIYQARFMKYMDARGMSPMNTRKVWAFLGDGEMDEPESTGAIG
LAVREKLDNLVFVINANLQRLDGPVRGNGKVVQELEGSFRGAGWNVIKVLWGPGWDVLLQ
KDTSGRLMQLMMETVDGEYQAYKAKNGAFVRENFFGKYPETAELVKNMTDEEIFGLTRGG
HSPRKMYAAYKAATEHKGQPTVIIAKTIKGYGMGPFGEGAMTAHNQKKLDVDGLKYFRDR
FGLPISDAQLENDVPFYKPEDSHELIKYLHERRSVLGGYLPSRVDRASSLPTPELSAFDM
ILKGTADREMSSTMLFGRILAIILRDKELGKRVVPIIPDEARTFGLEGLFRQVGIYDPAG
QLYEPVDADQVSWYKQATNGQVLQEGINEAGSMSSWLAAATAYANYGEAMIPFYIYYSMF
GYQRVGDLVWLGGDMRARGFIIGGTAGRTTLEGEGLQHQDGHNLVFFSAVPNCKAYDPTY
GYEMAVIIRAGLQEMFTDKKDVFYYITAMNENYPHPAMPEENRDQIEQGILRGLYPFSKS
KAKHKARVQLLGSGTILREVEKAAAMLEADWKVATDVWSATSFSELAREGQACVRENRLN
PEAPQKVPYVTATLEPTQGPIIAATDYIHLYTEQVRSFMPRRYVTLGTDGFGRSDTREAL
RKFFEVDAANIVITALKALADEGTIAASVVSQAIKKYDINPTLGMPSSR
Download sequence
Identical sequences D0L109
WP_012824416.1.355 555778.Hneap_1552 gi|261856146|ref|YP_003263429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]